Protein Info for BNILDI_12475 in Escherichia coli ECRC62

Name: nudK
Annotation: GDP-mannose pyrophosphatase NudK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 2 to 186 (185 residues), 270.2 bits, E=3.9e-85
• PF00293: NUDIX
  • amino acids 45 to 173 (129 residues), 41.6 bits, E=6.1e-15

Best Hits

Swiss-Prot: 100% identical to NUDK_ECO24: GDP-mannose pyrophosphatase NudK (nudK) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K12945, GDP-mannose pyrophosphatase NudK [EC: 3.6.1.-] (inferred from 99% identity to eco:b2467)

MetaCyc: 99% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"GDP-mannose pyrophosphatase YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (191 amino acids)

>BNILDI_12475 GDP-mannose pyrophosphatase NudK (Escherichia coli ECRC62)
MTQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNAKKKTV
VLIRQFRVATWVNGNESGQLIETCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYM
SPGGVTELIHFFIAEYSDNQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRDGKTVLL
LNYLQTSHLMD