Protein Info for BNILDI_12005 in Escherichia coli ECRC62

Name: ccmA
Annotation: heme ABC exporter ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF00005: ABC_tran" amino acids 26 to 178 (153 residues), 112.9 bits, see alignment E=2e-36 amino acids 278 to 432 (155 residues), 88.8 bits, see alignment E=5.5e-29

Best Hits

Swiss-Prot: 99% identical to YPHE_ECOLI: Uncharacterized ABC transporter ATP-binding protein YphE (yphE) from Escherichia coli (strain K12)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 99% identity to eco:b2547)

Predicted SEED Role

"Predicted sugar ABC transport system, ATP-binding protein YphE" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>BNILDI_12005 heme ABC exporter ATP-binding protein CcmA (Escherichia coli ECRC62)
MFTATEAVPVAKVVAGNKRYPGVVALDNVNFTLNKGEVRALLGKNGAGKSTLIRMLTGSE
RPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLTVAENLCLGQWPRRNGM
IDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARVMKGEPRVVILDEPTSSL
ASAEVELVISAVKKMSALGVAVIYVSHRMEEIRRIASCATVMRDGQVVGDVMLENTSTHH
IVSLMLGRDHVDIAPVAPQEIVDQAVLEVRALRHKPKLEDISFTLRRGEVLGIAGLLGAG
RSELLKAIVGLEEYEQGEIVINGEKITRPDYGDMLKRGISYTPENRKEAGIIPWLGVDEN
TVLTNRQKISANGVLQWSTIRRLTEEVMQRMTVKAASSETPIGTLSGGNQQKVVIGRWVY
AASQILLLDEPTRGVDIEAKQQIYRIVRELAAEGKSVVFISSEVEELPLVCDRILLLQHG
TFSQEFHSPVNVDELMSAILSVH