Protein Info for BNILDI_11500 in Escherichia coli ECRC62

Name: xerD
Annotation: integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00589: Phage_integrase" amino acids 175 to 247 (73 residues), 37.8 bits, see alignment E=8.4e-14 amino acids 261 to 321 (61 residues), 48 bits, see alignment E=6.5e-17

Best Hits

KEGG orthology group: None (inferred from 91% identity to stt:t4338)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>BNILDI_11500 integrase (Escherichia coli ECRC62)
MTVRKQPNGKWLCECYPNGRNGKRVRKQFATKGEAIAFESFTMEEVNKKPWLGEKDDRRR
LSELIELWYSLYGQTLADPKRLMAKLRIICNGLGDPIASELTAGDFTKYREARLKGEVRN
EDGVLMSPVKPRTVNLEQRNLSSVFGTLKKLGHWSAPNPLAGLPTFKIAEGELAFLTTEE
IKRLLDACADSHSSSLLMIAKICLATGARWSEAENLQGHQLTKYRITYTKTKGKKNRTIP
ISQELYDELPKNRGKLFTPCRKAFERAVKRAGIDLPEGQCTHVLRHTFASYFMMNGGNIL
VLKEILGHADIKMTMIYAHFSPDHLEDAVTKNPLNMIKL