Protein Info for BNILDI_11265 in Escherichia coli ECRC62

Name: ygaP
Annotation: thiosulfate sulfurtransferase YgaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details PF00581: Rhodanese" amino acids 7 to 98 (92 residues), 48.7 bits, see alignment E=8.6e-17 PF11127: YgaP-like_TM" amino acids 115 to 166 (52 residues), 32.7 bits, see alignment E=6.5e-12

Best Hits

Swiss-Prot: 98% identical to YGAP_ECOLI: Inner membrane protein YgaP (ygaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b2668)

MetaCyc: 98% identical to thiosulfate sulfurtransferase YgaP (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]

Predicted SEED Role

"Rhodanese-related sulfurtransferases"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>BNILDI_11265 thiosulfate sulfurtransferase YgaP (Escherichia coli ECRC62)
MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPPKLRREQI
IFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKRAGLPVAVNKSQPLPLMRQVQIA
AGGLILIGVVLGYTVNSGFFLLSGFVGAGLLFAGISGFCGMARLLDKMPWNQRT