Protein Info for BNILDI_11255 in Escherichia coli ECRC62

Name: alaE
Annotation: L-alanine exporter AlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details PF06610: AlaE" amino acids 5 to 141 (137 residues), 223.1 bits, see alignment E=7e-71

Best Hits

Swiss-Prot: 100% identical to ALAE_ECOLI: L-alanine exporter AlaE (alaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2670)

MetaCyc: 100% identical to AlaE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-469

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>BNILDI_11255 L-alanine exporter AlaE (Escherichia coli ECRC62)
MFSPQSRLRHAVADTFAMVVYCSVVNMCIEVFLSGMSFEQSFYSRLVAIPVNILIAWPYG
MYRDLFMRAARKVSPSGWIKNLADILAYVTFQSPVYVAILLVVGADWHQIMAAVSSNIVV
SMLMGAVYGYFLDYCRRLFKVSRYQQVKA