Protein Info for BNILDI_10885 in Escherichia coli ECRC62

Name: ygbN
Annotation: GntP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 102 to 132 (31 residues), see Phobius details amino acids 142 to 157 (16 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 386 to 409 (24 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details PF02447: GntP_permease" amino acids 5 to 453 (449 residues), 515.2 bits, see alignment E=1.4e-158 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 7 to 453 (447 residues), 345 bits, see alignment E=3.6e-107 PF03600: CitMHS" amino acids 19 to 395 (377 residues), 41 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 100% identical to YGBN_ECOLI: Inner membrane permease YgbN (ygbN) from Escherichia coli (strain K12)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to eco:b2740)

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>BNILDI_10885 GntP family transporter (Escherichia coli ECRC62)
MSTITLLCIALAGVIMLLLLVIKAKVQPFVALLLVSLLVALAAGIPAGEVGKVMIAGMGG
VLGSVTIIIGLGAMLGRMIEHSGGAESLANYFSRKLGDKRTIAALTLAAFFLGIPVFFDV
GFIILAPIIYGFAKVAKISPLKFGLPVAGIMLTVHVAVPPHPGPVAAAGLLHADIGWLTI
IGIAISIPVGIVGYFAAKIINKHQYAMSVEVLEQMQLAPASEEGATKLSDKINPPGVALV
TSLIVIPIAIIMAGTVSATLMPPSHPLLGTLQLIGSPMVALMIALVLAFWLLALRRGWSL
QHTSDIMGSALPTAAVVILVTGAGGVFGKVLVESGVGKALANMLQMIDLPLLPAAFIISL
ALRASQGSATVAILTTGGLLSEAVMGLNPIQCVLVTLAACFGGLGASHINDSGFWIVTKY
LGLSVADGLKTWTVLTTILGFTGFLITWCVWAVI