Protein Info for BNILDI_10785 in Escherichia coli ECRC62

Name: cas6e
Annotation: type I-E CRISPR-associated protein Cas6/Cse3/CasE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF08798: CRISPR_assoc" amino acids 1 to 212 (212 residues), 171.5 bits, see alignment E=1.7e-54 TIGR01907: CRISPR-associated protein Cas6/Cse3/CasE, subtype I-E/ECOLI" amino acids 1 to 212 (212 residues), 289.4 bits, see alignment E=1.3e-90

Best Hits

KEGG orthology group: None (inferred from 99% identity to sbo:SBO_2764)

Predicted SEED Role

"CRISPR-associated protein, Cse3 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>BNILDI_10785 type I-E CRISPR-associated protein Cas6/Cse3/CasE (Escherichia coli ECRC62)
MYLSRITLHTGQLSPAQLLHLVDRGEYVMHQWLWDLFPGGKERQFLYRREELQGAFRFFV
LSQERPAESDTFTIECRSFAPELCTGQQLCFNLRANPTICKAGKRHDLLMEAKRQVRGQA
EGSDVWLHQQQAALDWLAAQGERSGFTLLDTSVDAYRQQQLRRENSRQLIQFSSVDYTGM
LTVTDPGLFVQRLSQGYGKSRAFGCGLMLIKPGAEA