Protein Info for BNILDI_10690 in Escherichia coli ECRC62

Name: ygcW
Annotation: Uncharacterized oxidoreductase YgcW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 19 to 209 (191 residues), 180 bits, see alignment E=5.6e-57 PF08659: KR" amino acids 20 to 179 (160 residues), 51 bits, see alignment E=2.6e-17 PF13561: adh_short_C2" amino acids 27 to 258 (232 residues), 185.2 bits, see alignment E=2.2e-58

Best Hits

Swiss-Prot: 99% identical to YGCW_ECOLI: Uncharacterized oxidoreductase YgcW (ygcW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2774)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>BNILDI_10690 Uncharacterized oxidoreductase YgcW (Escherichia coli ECRC62)
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEM
IEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDP
MIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAY
CDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLEHIPANRWGDTQDLMGAAVFLA
SPASNYVNGHLLVVDGGYLVR