Protein Info for BNILDI_10625 in Escherichia coli ECRC62

Name: rlmD
Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF01938: TRAM" amino acids 11 to 67 (57 residues), 57.4 bits, see alignment 4.2e-19 TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA" amino acids 24 to 424 (401 residues), 568.2 bits, see alignment E=5.8e-175 PF05958: tRNA_U5-meth_tr" amino acids 254 to 431 (178 residues), 95.7 bits, see alignment E=1.2e-30 PF00398: RrnaAD" amino acids 270 to 342 (73 residues), 29.3 bits, see alignment E=1.8e-10 PF01135: PCMT" amino acids 272 to 340 (69 residues), 31.3 bits, see alignment E=7.2e-11 PF02475: TRM5-TYW2_MTfase" amino acids 284 to 342 (59 residues), 28.5 bits, see alignment E=5.7e-10 PF13847: Methyltransf_31" amino acids 287 to 392 (106 residues), 54.3 bits, see alignment E=5e-18 PF13649: Methyltransf_25" amino acids 290 to 361 (72 residues), 34.3 bits, see alignment E=1.2e-11 PF08241: Methyltransf_11" amino acids 291 to 361 (71 residues), 23.7 bits, see alignment E=2.5e-08

Best Hits

Swiss-Prot: 100% identical to RLMD_ECOLI: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Escherichia coli (strain K12)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to eco:b2785)

MetaCyc: 100% identical to 23S rRNA m5U1939 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11601 [EC: 2.1.1.190]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.190

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>BNILDI_10625 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Escherichia coli ECRC62)
MAQFYSAKRRTTTRQIITVSVNDLDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQ
YARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKHDVSEVI
ADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPILAPQLEALQPKVRACL
GSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDSEILE
TVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNF
TLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKV
LLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLDMFPHT
GHLESMVLFSRVK