Protein Info for BNILDI_10565 in Escherichia coli ECRC62

Name: sdaC
Annotation: HAAAP family serine/threonine permease SdaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 369 to 371 (3 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details TIGR00814: serine transporter" amino acids 18 to 418 (401 residues), 618.7 bits, see alignment E=2.4e-190

Best Hits

Swiss-Prot: 100% identical to SDAC_ECOLI: Serine transporter (sdaC) from Escherichia coli (strain K12)

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to eco:b2796)

MetaCyc: 100% identical to L-serine:H+ symporter SdaC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>BNILDI_10565 HAAAP family serine/threonine permease SdaC (Escherichia coli ECRC62)
METTQTSTIASKDSRSAWRKTDTMWMLGLYGTAIGAGVLFLPINAGVGGMIPLIIMAILA
FPMTFFAHRGLTRFVLSGKNPGEDITEVVEEHFGIGAGKLITLLYFFAIYPILLVYSVAI
TNTVESFMSHQLGMTPPPRAILSLILIVGMMTIVRFGEQMIVKAMSILVFPFVGVLMLLA
LYLIPQWNGAALETLSLDTASATGNGLWMTLWLAIPVMVFSFNHSPIISSFAVAKREEYG
DMAEQKCSKILAFAHIMMVLTVMFFVFSCVLSLTPADLAAAKEQNISILSYLANHFNAPV
IAWMAPIIAIIAITKSFLGHYLGAREGFNGMVIKSLRGKGKSIEINKLNRITALFMLVTT
WIVATLNPSILGMIETLGGPIIAMILFLMPMYAIQKVPAMRKYSGHISNVFVVVMGLIAI
SAIFYSLFS