Protein Info for BNILDI_10545 in Escherichia coli ECRC62

Name: fucA
Annotation: L-fuculose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR01086: L-fuculose phosphate aldolase" amino acids 2 to 215 (214 residues), 443.9 bits, see alignment E=4.9e-138 PF00596: Aldolase_II" amino acids 9 to 182 (174 residues), 187.7 bits, see alignment E=1e-59

Best Hits

Swiss-Prot: 100% identical to FUCA_ECO57: L-fuculose phosphate aldolase (fucA) from Escherichia coli O157:H7

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to eco:b2800)

MetaCyc: 100% identical to L-fuculose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
L-fuculose-phosphate aldolase. [EC: 4.1.2.17]; 4.1.2.17 [EC: 4.1.2.17]

Predicted SEED Role

"L-fuculose phosphate aldolase (EC 4.1.2.17)" in subsystem L-fucose utilization (EC 4.1.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>BNILDI_10545 L-fuculose-phosphate aldolase (Escherichia coli ECRC62)
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE