Protein Info for BNILDI_10525 in Escherichia coli ECRC62

Name: fucU
Annotation: L-fucose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF05025: RbsD_FucU" amino acids 3 to 139 (137 residues), 124.2 bits, see alignment E=2.8e-40

Best Hits

Swiss-Prot: 100% identical to FUCM_ECO45: L-fucose mutarotase (fucU) from Escherichia coli O45:K1 (strain S88 / ExPEC)

KEGG orthology group: K02431, L-fucose mutarotase [EC: 5.1.3.-] (inferred from 100% identity to eco:b2804)

MetaCyc: 100% identical to L-fucose mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5304 [EC: 5.4.99.62]; RXN0-5298 [EC: 5.4.99.62, 5.1.3.29]

Predicted SEED Role

"L-fucose mutarotase" in subsystem L-fucose utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.- or 5.1.3.29 or 5.4.99.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>BNILDI_10525 L-fucose mutarotase (Escherichia coli ECRC62)
MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRADGLLVSDLLQAIIPL
FELDSYAPPLVMMAAVEGDTLDPEVERRYRNALSLQAPCPDIIRINRFAFYERAQKAFAI
VITGERAKYGNILLKKGVTP