Protein Info for BNILDI_10065 in Escherichia coli ECRC62

Name: ygfT
Annotation: formate-dependent uric acid utilization protein YgfT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 PF13247: Fer4_11" amino acids 53 to 137 (85 residues), 45.1 bits, see alignment E=6.4e-15 PF12838: Fer4_7" amino acids 56 to 101 (46 residues), 32.4 bits, see alignment 6.8e-11 PF25160: LdpA_Fe-S-bd" amino acids 61 to 105 (45 residues), 28.1 bits, see alignment 9.4e-10 PF00037: Fer4" amino acids 81 to 102 (22 residues), 27.9 bits, see alignment (E = 9.5e-10) PF12837: Fer4_6" amino acids 83 to 101 (19 residues), 27.1 bits, see alignment (E = 1.9e-09) TIGR01318: glutamate synthase, small subunit" amino acids 171 to 635 (465 residues), 848.5 bits, see alignment E=5.5e-260 PF14691: Fer4_20" amino acids 188 to 298 (111 residues), 126.7 bits, see alignment E=2.4e-40 PF00070: Pyr_redox" amino acids 312 to 383 (72 residues), 26.6 bits, see alignment E=4.7e-09 PF01494: FAD_binding_3" amino acids 312 to 343 (32 residues), 25.3 bits, see alignment (E = 5.8e-09) PF07992: Pyr_redox_2" amino acids 312 to 623 (312 residues), 74.2 bits, see alignment E=8.1e-24 PF13450: NAD_binding_8" amino acids 315 to 349 (35 residues), 33.6 bits, see alignment (E = 2.5e-11)

Best Hits

Swiss-Prot: 100% identical to YGFT_ECOLI: Uncharacterized protein YgfT (ygfT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2887)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>BNILDI_10065 formate-dependent uric acid utilization protein YgfT (Escherichia coli ECRC62)
MNKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRPRIHVVGKGQAANPVACHHCN
NAPCVTACPVNALTFQSDSVQLDEQKCIGCKRCAIACPFGVVEMVDTIAQKCDLCNQRSS
GTQACIEVCPTQALRLMDDKGLQQIKVARQRKTAAGKASSDAQPSRSAALLPVNSRKGAD
KISASERKTHFGEIYCGLDPQQATYESDRCVYCAEKANCNWHCPLHNAIPDYIRLVQEGK
IIEAAELCHQTSSLPEICGRVCPQDRLCEGACTLKDHSGAVSIGNLERYITDTALAMGWR
PDVSKVVPRIEKVAVIGAGPAGLGCADILARAGVQVDVFDRHPEIGGMLTFGIPPFKLDK
TVLSQRREIFTAMGIDFHLNCEIGRDITFSDLTSEYDAVFIGVGTYGMMRADLPHEDAPG
VIQALPFLTAHTRQLMGLPESEEYPLTDVEGKRVVVLGGGDTTMDCLRTSIRLNAASVTC
AYRRDEVSMPGSRKEVVNAREEGVEFQFNVQPQYIACDEDGRLTAVGLIRTAMGEPGPDG
RRRPRPVAGSEFELPADVLIMAFGFQAHAMPWLQGSGIKLDKWGLIQTGDVGYLPTQTHL
KKVFAGGDAVHGADLVVTAMAAGRQAARDMLTLFDTKAS