Protein Info for BNILDI_10050 in Escherichia coli ECRC62

Name: idi
Annotation: isopentenyl-diphosphate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02150: isopentenyl-diphosphate delta-isomerase" amino acids 6 to 165 (160 residues), 153.4 bits, see alignment E=2.3e-49 PF00293: NUDIX" amino acids 31 to 161 (131 residues), 74.5 bits, see alignment E=4.4e-25

Best Hits

Swiss-Prot: 99% identical to IDI_ECOLC: Isopentenyl-diphosphate Delta-isomerase (idi) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 96% identity to eco:b2889)

MetaCyc: 96% identical to isopentenyl-diphosphate Delta-isomerase (Escherichia coli K-12 substr. MG1655)
Isopentenyl-diphosphate Delta-isomerase. [EC: 5.3.3.2]

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or polyprenyl synthesis (EC 5.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>BNILDI_10050 isopentenyl-diphosphate Delta-isomerase (Escherichia coli ECRC62)
MQTEHVILLNAQGVPTGTLEKYAAHTADTLLHLAFSSWLFNAKGQLLVTRRALSKKAWPG
VWTNSVCGHPQLGESSEDAVIRRCRYELGVEITPPESIYPDFRYRATDPSGIVENEVCPV
FAARTTSALQINDDEVMDYQWCDLADVLHGIDATPWAFSPWMVMQAANSEARKLLSTFAQ
HN