Protein Info for BNILDI_09510 in Escherichia coli ECRC62

Annotation: IS5-like element ISKpn26 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF05598: DUF772" amino acids 51 to 124 (74 residues), 75.2 bits, see alignment E=3.4e-25 PF01609: DDE_Tnp_1" amino acids 138 to 312 (175 residues), 121.8 bits, see alignment E=3.3e-39

Best Hits

Swiss-Prot: 99% identical to INSH5_ECOLI: Transposase InsH for insertion sequence element IS5Y (insH5) from Escherichia coli (strain K12)

KEGG orthology group: K07481, transposase, IS5 family (inferred from 99% identity to eco:b1370)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>BNILDI_09510 IS5-like element ISKpn26 family transposase (Escherichia coli ECRC62)
MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPFYPKAGNGRRPYPLETM
LRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQ
LFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAH
IGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWL
IAERPGKVKTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKRLLKND
NQLAMLFTLANLFRVDQMIRQWERSH