Protein Info for BNILDI_09150 in Escherichia coli ECRC62

Name: rseP
Annotation: sigma E protease regulator RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 56 to 72 (17 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 3 to 450 (448 residues), 609 bits, see alignment E=2.1e-187 PF02163: Peptidase_M50" amino acids 11 to 438 (428 residues), 265.6 bits, see alignment E=7.3e-83 PF00595: PDZ" amino acids 209 to 277 (69 residues), 44.3 bits, see alignment E=4.8e-15 PF13180: PDZ_2" amino acids 212 to 287 (76 residues), 33.9 bits, see alignment E=7.8e-12 PF17820: PDZ_6" amino acids 227 to 278 (52 residues), 44.8 bits, see alignment 2.1e-15

Best Hits

Swiss-Prot: 100% identical to RSEP_ECO57: Regulator of sigma E protease (rseP) from Escherichia coli O157:H7

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to eco:b0176)

MetaCyc: 100% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>BNILDI_09150 sigma E protease regulator RseP (Escherichia coli ECRC62)
MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV
IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAILAYWLVF
IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI
TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL
QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG
FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG
PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS
ERVQDFCYRIGSILLVLLMGLALFNDFSRL