Protein Info for BNILDI_09105 in Escherichia coli ECRC62

Name: rpsB
Annotation: 30S ribosomal protein S2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01011: ribosomal protein uS2
  • amino acids 3 to 226 (224 residues), 359.4 bits, E=2.9e-112
• PF00318: Ribosomal_S2
  • amino acids 9 to 224 (216 residues), 326.1 bits, E=4e-102

Best Hits

Swiss-Prot: 100% identical to RS2_ECOSE: 30S ribosomal protein S2 (rpsB) from Escherichia coli (strain SE11)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 100% identity to eco:b0169)

MetaCyc: 100% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Protein Sequence (241 amino acids)

>BNILDI_09105 30S ribosomal protein S2 (Escherichia coli ECRC62)
MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKI
ASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQ
SQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLG
IPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEA
E