Protein Info for BNILDI_09070 in Escherichia coli ECRC62

Name: degP
Annotation: serine endoprotease DegP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 40 to 472 (433 residues), 556.7 bits, see alignment E=1.9e-171 PF00089: Trypsin" amino acids 108 to 275 (168 residues), 86.2 bits, see alignment E=7.3e-28 PF13365: Trypsin_2" amino acids 114 to 250 (137 residues), 118.1 bits, see alignment E=1.4e-37 PF00595: PDZ" amino acids 287 to 367 (81 residues), 57.4 bits, see alignment E=3.9e-19 amino acids 393 to 463 (71 residues), 48.2 bits, see alignment E=3e-16 PF13180: PDZ_2" amino acids 305 to 380 (76 residues), 54.7 bits, see alignment E=2.7e-18 amino acids 406 to 464 (59 residues), 36.7 bits, see alignment E=1.1e-12 PF17820: PDZ_6" amino acids 315 to 351 (37 residues), 40 bits, see alignment 7e-14 amino acids 412 to 464 (53 residues), 37.8 bits, see alignment 3.4e-13

Best Hits

Swiss-Prot: 100% identical to DEGP_ECO57: Periplasmic serine endoprotease DegP (degP) from Escherichia coli O157:H7

KEGG orthology group: K04771, serine protease Do [EC: 3.4.21.107] (inferred from 100% identity to eco:b0161)

MetaCyc: 100% identical to periplasmic serine endoprotease DegP (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>BNILDI_09070 serine endoprotease DegP (Escherichia coli ECRC62)
MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGS
TTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIID
ADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMAD
SDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGAL
VNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNS
ELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVG
SKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGT
PAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ