Protein Info for BNILDI_09035 in Escherichia coli ECRC62

Name: clcA
Annotation: H(+)/Cl(-) exchange transporter ClcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 90 to 436 (347 residues), 331.5 bits, see alignment E=3.3e-103

Best Hits

Swiss-Prot: 100% identical to CLCA_ECOSE: H(+)/Cl(-) exchange transporter ClcA (clcA) from Escherichia coli (strain SE11)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to eco:b0155)

MetaCyc: 100% identical to chloride:H+ antiporter ClcA (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"H(+)/Cl(-) exchange transporter ClcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>BNILDI_09035 H(+)/Cl(-) exchange transporter ClcA (Escherichia coli ECRC62)
MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWL
QNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQR
PVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVLDIFRLKGDEARHTLLAT
GAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALID
VGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGG
LCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPM
LALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQ
LILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEAEQLARSKAASASENT