Protein Info for BNILDI_08855 in Escherichia coli ECRC62

Annotation: Putative prophage primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 325 to 339 (15 residues), see Phobius details PF06048: DUF927" amino acids 168 to 370 (203 residues), 110.1 bits, see alignment E=8.2e-36

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 82% identity to ece:Z1842)

Predicted SEED Role

"DNA primase (EC 2.7.7.-), phage-associated" in subsystem DNA-replication (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>BNILDI_08855 Putative prophage primase (Escherichia coli ECRC62)
MKKAPNLKHQPRDKMTEVIIFAGSDAWAHANQWQEQDGRLAGDNVPPVWLGEQQLAELDN
LQIVPDGRYRVRLYQAGLLRPGLVNTIGQKLAAAGVRDADYYPEGMHSQKRENWREYLER
ERAEQAEKKKVVELPVKKKEPCYQDDELKPSVESRVDGVFWVTPKVDKQSGEIIRPETWL
CSPLELLGTGTIGKEHYRVMRWKKLANHEVITMAIPCGGIGDRDGWRLLKDHGLNVTTNG
KYRAILADWMQLSGSHEEWQLSTTTGWHFGAYIMPDGSIIGDSEKPILFTGKSAAVNGYS
VAGTAEGWRDSVARLAGGNPSMMLGVATSLAAPLIGLVGADGFGVHLFEQSSAGKTTTQN
IASSLWGEQTA