Protein Info for BNILDI_08720 in Escherichia coli ECRC62

Name: hofC
Annotation: protein transport protein HofC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 163 to 185 (23 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF00482: T2SSF" amino acids 64 to 186 (123 residues), 105.2 bits, see alignment E=1.2e-34 amino acids 269 to 388 (120 residues), 86.6 bits, see alignment E=7e-29

Best Hits

Swiss-Prot: 99% identical to HOFC_ECOLI: Protein transport protein HofC homolog (hofC) from Escherichia coli (strain K12)

KEGG orthology group: K02505, protein transport protein HofC (inferred from 99% identity to eco:b0106)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>BNILDI_08720 protein transport protein HofC (Escherichia coli ECRC62)
MASKQLWRWHGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSLKRIAINSAQWRGDKS
AEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDLEQGIAFSNALLPWSEV
FPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSALRYPIIILAMAIMVVVAM
LHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVLFGFLLAIANKLLMRRPTW
LIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFLQGVESVRETMRCPYWVQLL
TQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSLDLMLDNLAHHHRDNTMALAD
NLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGMG