Protein Info for BNILDI_08715 in Escherichia coli ECRC62

Name: guaC
Annotation: GMP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR01305: guanosine monophosphate reductase" amino acids 2 to 344 (343 residues), 709.2 bits, see alignment E=3.7e-218 PF00478: IMPDH" amino acids 9 to 338 (330 residues), 256.7 bits, see alignment E=1.6e-80

Best Hits

Swiss-Prot: 100% identical to GUAC_ECOSE: GMP reductase (guaC) from Escherichia coli (strain SE11)

KEGG orthology group: K00364, GMP reductase [EC: 1.7.1.7] (inferred from 100% identity to eco:b0104)

MetaCyc: 100% identical to GMP reductase (Escherichia coli K-12 substr. MG1655)
GMP reductase. [EC: 1.7.1.7]

Predicted SEED Role

"GMP reductase (EC 1.7.1.7)" in subsystem Purine conversions (EC 1.7.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>BNILDI_08715 GMP reductase (Escherichia coli ECRC62)
MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTF
SMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTGTSDADFEKTKQILDLN
PALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGEMCEELILSGADIVKVGI
GPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGCTTPGDVAKAFGGGADFVM
LGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGGVAEYRAAEGKTVKLPLRGP
VENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQENRIFNNL