Protein Info for BNILDI_08675 in Escherichia coli ECRC62

Name: secA
Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 901 PF07517: SecA_DEAD" amino acids 7 to 401 (395 residues), 434.4 bits, see alignment E=6.2e-134 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 817 (790 residues), 1162.2 bits, see alignment E=0 PF00270: DEAD" amino acids 95 to 216 (122 residues), 25.1 bits, see alignment E=4e-09 PF01043: SecA_PP_bind" amino acids 232 to 358 (127 residues), 138.1 bits, see alignment E=5.4e-44 PF21090: P-loop_SecA" amino acids 417 to 614 (198 residues), 308.1 bits, see alignment E=8.5e-96 PF07516: SecA_SW" amino acids 617 to 830 (214 residues), 245.5 bits, see alignment E=1.6e-76 PF02810: SEC-C" amino acids 881 to 899 (19 residues), 41 bits, see alignment (E = 4e-14)

Best Hits

Swiss-Prot: 73% identical to SECA_ALIFM: Protein translocase subunit SecA (secA) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 75% identity to avr:B565_0352)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (901 amino acids)

>BNILDI_08675 preprotein translocase subunit SecA (Escherichia coli ECRC62)
MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVL
ENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA
LTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVN
KIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYS
PANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
KDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLN
AKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTVEQIEKIKAD
WQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFAS
DRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
SQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPI
AEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEEL
EQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRL
Q