Protein Info for BNILDI_08295 in Escherichia coli ECRC62

Name: lspA
Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 1 to 164 (164 residues), 204 bits, see alignment E=7.1e-65 PF01252: Peptidase_A8" amino acids 15 to 155 (141 residues), 141.3 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 100% identical to LSPA_ECOLI: Lipoprotein signal peptidase (lspA) from Escherichia coli (strain K12)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to eco:b0027)

MetaCyc: 100% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>BNILDI_08295 signal peptidase II (Escherichia coli ECRC62)
MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPSLNLHYARNYGAAFSF
LADSGGWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF
VVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSRAKKQ