Protein Info for BNILDI_08110 in Escherichia coli ECRC62

Name: yjjX
Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00258: inosine/xanthosine triphosphatase" amino acids 6 to 170 (165 residues), 239.1 bits, see alignment E=1.4e-75 PF01931: NTPase_I-T" amino acids 7 to 165 (159 residues), 174.8 bits, see alignment E=6.3e-56

Best Hits

Swiss-Prot: 99% identical to NCPP_ECOLC: Inosine/xanthosine triphosphatase (yjjX) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: None (inferred from 99% identity to eco:b4394)

MetaCyc: 99% identical to inosine/xanthosine triphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-5073 [EC: 3.6.1.73]; 3.6.1.73 [EC: 3.6.1.73]

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>BNILDI_08110 inosine/xanthosine triphosphatase (Escherichia coli ECRC62)
MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEETRAGARNRVA
NARRLLPEADFWVAIEAGIDGDSTFSWVVIENTSQRGEARSATLPLPAVILQKVREGEAL
GPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVILALSPFHNAVYQAL