Protein Info for BNILDI_08065 in Escherichia coli ECRC62

Name: ahpA
Annotation: YtjB family periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 164 to 184 (21 residues), see Phobius details PF10144: SMP_2" amino acids 1 to 160 (160 residues), 230.7 bits, see alignment E=3.5e-73

Best Hits

Swiss-Prot: 100% identical to SMP_ECO57: Protein Smp (smp) from Escherichia coli O157:H7

KEGG orthology group: K07186, membrane protein (inferred from 100% identity to eco:b4387)

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>BNILDI_08065 YtjB family periplasmic protein (Escherichia coli ECRC62)
MARTKLKFRLHRAVIVLFCLALLVALMQGASWFSQNHQRQRNPQLEELARTLARQVTLNV
APLMRTDSPDEKRIQAILDQLTDESRILDADVYDEQGDLIARSGESVEVRDRLALDGKKA
GGYFNQQIVEPIAGKNGPLGYLRLTLDTHTLATEAQQVDNTTNILRLMLLLSLAIGVVLT
RTLLQGKRTRWQQSPFLLTASKPVPEEEESEKKE