Protein Info for BNILDI_07870 in Escherichia coli ECRC62

Name: hpcD
Annotation: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF02962: CHMI" amino acids 2 to 125 (124 residues), 165.8 bits, see alignment E=2.7e-53

Best Hits

Swiss-Prot: 98% identical to HPCD_ECOLX: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase (hpcD) from Escherichia coli

KEGG orthology group: K01826, 5-carboxymethyl-2-hydroxymuconate isomerase [EC: 5.3.3.10] (inferred from 99% identity to ecy:ECSE_4626)

MetaCyc: 100% identical to 5-carboxymethyl-2-hydroxymuconate isomerase (Escherichia coli B)
5-carboxymethyl-2-hydroxymuconate Delta-isomerase. [EC: 5.3.3.10]

Predicted SEED Role

"5-carboxymethyl-2-hydroxymuconate delta-isomerase (EC 5.3.3.10)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.3.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>BNILDI_07870 5-carboxymethyl-2-hydroxymuconate Delta-isomerase (Escherichia coli ECRC62)
MPHFIVECSDNIREEADLPGLFAKVNPTLAATGIFPLAGIRSRVHWVDTWQMADGQRDYA
FVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEIEELHPTLNFKQNN
VHALFK