Protein Info for BNILDI_07670 in Escherichia coli ECRC62

Name: fimI
Annotation: Fimbrin-like protein fimI precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF00419: Fimbrial" amino acids 19 to 165 (147 residues), 118.9 bits, see alignment E=1.2e-38

Best Hits

Swiss-Prot: 99% identical to FIMI_ECOLI: Fimbrin-like protein FimI (fimI) from Escherichia coli (strain K12)

KEGG orthology group: K07351, fimbrial protein (inferred from 99% identity to eco:b4315)

Predicted SEED Role

"type 1 fimbriae protein FimI, unknown function"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>BNILDI_07670 Fimbrin-like protein fimI precursor (Escherichia coli ECRC62)
MFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPV
PFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPIN
RPPANWKRLYSGSTSLHFIAKYRATGHRVTGGIANAQAWFSLTYQ