Protein Info for BNILDI_07505 in Escherichia coli ECRC62

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09339: HTH_IclR
  • amino acids 12 to 61 (50 residues), 33.9 bits, 2.2e-12
• PF01614: IclR
  • amino acids 127 to 249 (123 residues), 121.7 bits, E=1.8e-39

Best Hits

Swiss-Prot: 35% identical to YJHI_ECOLI: Uncharacterized HTH-type transcriptional regulator YjhI (yjhI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to cko:CKO_05138)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Protein Sequence (254 amino acids)

>BNILDI_07505 IclR family transcriptional regulator (Escherichia coli ECRC62)
MNNQTIRTSVPALDKTVRVCNYLFSSPGATFSQIQQDLDLPKSSTSSLLNALVEHHLLRQ
ERGRFFLGLKLYEWGNRSLEQFDISKVARPVLEKLRDSTDLICHLGILDEVAPIYILKLE
STQPIGIRTWVGKKLPLHSSGVGKALCAWLPQDVIDTLLPEETLPRFTQTTITRKSDLIQ
EFARIRERGWAFDNAEDSPGIYCIAAPVFNQTREVIAAISISGVEIQIPKEKIEYYSTLV
LDACQELSEKLKYI