Protein Info for BNILDI_07155 in Escherichia coli ECRC62
Annotation: acyl-CoA hydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 34% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
KEGG orthology group: None (inferred from 96% identity to ecq:ECED1_5059)MetaCyc: 34% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]
Predicted SEED Role
"3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism (EC 4.2.1.55)
MetaCyc Pathways
- acrylate degradation II (3/3 steps found)
- acetyl-CoA fermentation to butanoate (5/7 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
- superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- β-alanine biosynthesis II (2/6 steps found)
- acrylate degradation I (1/5 steps found)
- propanoyl-CoA degradation II (1/5 steps found)
- glyoxylate assimilation (6/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
- ethylmalonyl-CoA pathway (2/11 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.116 or 4.2.1.55
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (258 amino acids)
>BNILDI_07155 acyl-CoA hydratase (Escherichia coli ECRC62) MSDQPVLFSRVAASCRLTLNREDKCHAINEEMIESLDHYLNEIENDTTLRLVELTATGDK FFCAGGDIKSWSAYSPLDMGRKWIKRGNDVFNRLRNLPQLTVANLNGHTIGGGIELALCC DIRIARPGAKFSNPEVMLGMVPGWMGIERVLNQVGPVVGRQMLMLGKRLTAQEAQAANLI DEVVEIEQVESWMANQLAQLEKCGPVALAHIKQLILALENKHADYPHQLLAGLMSATQDC QQATRAFAEKSSVSFHNQ