Protein Info for BNILDI_07040 in Escherichia coli ECRC62

Name: yjfC
Annotation: Putative acid--amine ligase YjfC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF03738: GSP_synth" amino acids 14 to 385 (372 residues), 498.2 bits, see alignment E=8.5e-154

Best Hits

Swiss-Prot: 98% identical to YJFC_ECOLI: Putative acid--amine ligase YjfC (yjfC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b4186)

MetaCyc: 98% identical to peptide--spermidine ligase YjfC (Escherichia coli K-12 substr. MG1655)
6.3.1.-

Predicted SEED Role

"Similarity with glutathionylspermidine synthase (EC 6.3.1.8), group 1" in subsystem Glutathionylspermidine and Trypanothione (EC 6.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.8

Use Curated BLAST to search for 6.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>BNILDI_07040 Putative acid--amine ligase YjfC (Escherichia coli ECRC62)
MLRHNVPVRRDLDQIAANNGFDFHIIDNEIYWDESRAYRFTLRQIEEQIEKPTAELHQMC
LEVVDRAVKDEEILTQLAIPPLYWDVIAESWRARDPSLYGRMDFAWCGNAPVKLLEYNAD
TPTSLYESAYFQWLWLEDARRSGIIPRDADQYNAIQERLISRFSELYSREPFYFCCCQDT
DEDRTTVLYLQDCAQQAGQESRFIYIEDLGLGVGGVLTDLDDNVIQRAFKLYPLEWMMRD
DNGPLLCKRREQWVEPLWKSILSNKGLMPLLWRFFPGHPNLLASWFEGEKSQIAAGESYV
RKPIYSREGGNVTIFDGQNNVVDHADGDYADEPMIYQAFQPLPRFGDSYTLIGSWIVDDE
ACGMGIREDNTLITKDTSRFVPHYIAG