Protein Info for BNILDI_06385 in Escherichia coli ECRC62

Name: ssb1
Annotation: single-stranded DNA-binding protein SSB1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR00621: single-stranded DNA-binding protein" amino acids 3 to 178 (176 residues), 207.7 bits, see alignment E=7.2e-66 PF00436: SSB" amino acids 6 to 112 (107 residues), 140.8 bits, see alignment E=7.5e-46

Best Hits

Swiss-Prot: 100% identical to SSB_ECOL6: Single-stranded DNA-binding protein (ssb) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to eco:b4059)

MetaCyc: 100% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>BNILDI_06385 single-stranded DNA-binding protein SSB1 (Escherichia coli ECRC62)
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGG
APAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF