Protein Info for BNILDI_06260 in Escherichia coli ECRC62

Name: malM
Annotation: maltose operon protein MalM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07148: MalM" amino acids 76 to 209 (134 residues), 170.4 bits, see alignment E=8.3e-55

Best Hits

Swiss-Prot: 100% identical to MALM_ECOLI: Maltose operon periplasmic protein (malM) from Escherichia coli (strain K12)

KEGG orthology group: K05775, maltose operon periplasmic protein (inferred from 100% identity to eco:b4037)

Predicted SEED Role

"Maltose operon periplasmic protein MalM" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>BNILDI_06260 maltose operon protein MalM (Escherichia coli ECRC62)
MKMNKSLIALCLSAGLLASAPGISLADVNYVPQNTSDAPAIPSAALQQLTWTPVDQSKTQ
TTQLATGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNKQTSVFAPNVLILDQNMTP
SAFFPSSYFTYQEPGVMSADRLEGVMRLTPALGQQKLYVLVFTTEKDLQQTTQLLDPAKA
YAKGVGNSIPDIPDPVARHTTDGLLKLKVKTNSSSSVLVGPLFGSSAPAPVTVGNTAAPA
VAAPAPAPVKKSEPMLNDTESYFNTAIKNAVAKGDVDKALKLLDEAERLGSTSARSTFIS
SVKGKG