Protein Info for BNILDI_05790 in Escherichia coli ECRC62

Name: argE
Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01892: acetylornithine deacetylase (ArgE)
  • amino acids 10 to 377 (368 residues), 572.5 bits, E=1.8e-176
• PF04389: Peptidase_M28
  • amino acids 73 to 156 (84 residues), 22.6 bits, E=1.1e-08
• PF01546: Peptidase_M20
  • amino acids 76 to 378 (303 residues), 116.3 bits, E=2.8e-37
• PF07687: M20_dimer
  • amino acids 178 to 287 (110 residues), 88.9 bits, E=3.1e-29

Best Hits

Swiss-Prot: 100% identical to ARGE_ECO8A: Acetylornithine deacetylase (argE) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 100% identity to eco:b3957)

MetaCyc: 100% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Protein Sequence (383 amino acids)

>BNILDI_05790 acetylornithine deacetylase (Escherichia coli ECRC62)
MKNKLPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRN
KFNMLASCGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFI
LDALRDVDVTKLKKSLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHK
GHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLN
LGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHP
PIPGYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVIHHFCWH