Protein Info for BNILDI_05780 in Escherichia coli ECRC62

Name: ibeC
Annotation: phosphoethanolamine transferase CptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details PF00884: Sulfatase" amino acids 237 to 529 (293 residues), 203.2 bits, see alignment E=3.1e-64

Best Hits

Swiss-Prot: 99% identical to EPTC_ECOLI: Phosphoethanolamine transferase EptC (eptC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3955)

MetaCyc: 99% identical to phosphoethanolamine transferase EptC (Escherichia coli K-12 substr. MG1655)
2.7.8.M9 [EC: 2.7.8.M9]

Predicted SEED Role

"UPF0141 membrane protein YijP possibly required for phosphoethanolamine modification of lipopolysaccharide" in subsystem Lipid A modifications

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.M9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>BNILDI_05780 phosphoethanolamine transferase CptA (Escherichia coli ECRC62)
MHSTEVQAKPLFSWKALGWALLYFWFFSTLLQAIIYISGYSGTNGIRDSLLFSSLWLIPV
FLFPKRIKIIAAVIGVVLWAASLAALCYYVIYGQEFSQSVLFVMFETNTNEASEYLSQYF
SLKIVLIALAYTAMAVLLWTRLRPVYIPKPWRYIVSFALLYGLILHPIAMNTFIKNKPFE
KTLDNLASRMEPAAPWQFLTGYYQYRQQLNSLTKLLNENNALPPLANFKDESGNEPRTLV
LVIGESTQRGRMSLYGYPRETTPELDALHKTDPNLTVFNNVVTSRPYTIEILQQALTFAN
EKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTMTARNTMLTVFSKQTDKQFYMNQQRTQS
AREYDTNVLKPFQEVLKDPAPKKLIIVHLLGTHIKYKYRYPENQGKFDGNTDHVPPGLSA
EELESYNDYDNANLYNDHVVASLIKDFKAADPNGFLVYFSDHGEEVYDTPPHKTQGRNED
NPTRHMYTIPFLLWTSEKWQATHPRDFSQDVDRKYSLAELIHTWSDLAGLSYDGYDPTRS
VVNPQFKETTRWIGNPYKKNALIDYDTLPYGDQVGNQ