Protein Info for BNILDI_05550 in Escherichia coli ECRC62

Name: cpxP
Annotation: cell-envelope stress modulator CpxP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07813: LTXXQ" amino acids 41 to 135 (95 residues), 77.7 bits, see alignment E=5e-26

Best Hits

Swiss-Prot: 100% identical to CPXP_SHIFL: Periplasmic protein CpxP (cpxP) from Shigella flexneri

KEGG orthology group: K06006, periplasmic protein CpxP (inferred from 100% identity to eco:b4484)

Predicted SEED Role

"P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>BNILDI_05550 cell-envelope stress modulator CpxP (Escherichia coli ECRC62)
MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHMFDGISLTEHQRQQMR
DLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQM
YRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ