Protein Info for BNILDI_05000 in Escherichia coli ECRC62

Name: yigE
Annotation: Uncharacterized protein YigE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF09992: NAGPA" amino acids 84 to 237 (154 residues), 70.1 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 99% identical to YIGE_ECOLI: Uncharacterized protein YigE (yigE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b4482)

Predicted SEED Role

"hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>BNILDI_05000 Uncharacterized protein YigE (Escherichia coli ECRC62)
MAHRLLIGKGMITLNLKRIFLALTLLPLFAVAADDCALSDPTLTVQAYTVNPQTERVKMY
WQKANGEAWGTLHALLADMNSQGQVQMAMNGGIYDESYAPLGLYIENGQQKVALNLASGE
GNFFIRPGGVFYVAGDKVGIVRLDAFKTSKEIQFAVQSGPMLMENGVINPRIHPNVASRK
IRNGVGINKHGNAVFLLSQQATNFYDFACYAKAKLNVEQLLYLDGTISHMYMKGGAIPWQ
RYPFVTMISVERKG