Protein Info for BNILDI_04935 in Escherichia coli ECRC62

Name: hemD
Annotation: uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF02602: HEM4" amino acids 14 to 242 (229 residues), 152.8 bits, see alignment E=4.2e-49

Best Hits

Swiss-Prot: 99% identical to HEM4_ECOLI: Uroporphyrinogen-III synthase (hemD) from Escherichia coli (strain K12)

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 99% identity to eco:b3804)

MetaCyc: 99% identical to uroporphyrinogen-III synthase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen-III synthase. [EC: 4.2.1.75]

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>BNILDI_04935 uroporphyrinogen-III synthase (Escherichia coli ECRC62)
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
MVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ