Protein Info for BNILDI_04840 in Escherichia coli ECRC62

Name: rffC
Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02382: TDP-D-fucosamine acetyltransferase
  • amino acids 44 to 224 (181 residues), 319.9 bits, E=2.5e-100
• PF00583: Acetyltransf_1
  • amino acids 115 to 208 (94 residues), 27.4 bits, E=3.7e-10

Best Hits

Swiss-Prot: 99% identical to WECD_ECOLI: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3790)

MetaCyc: 99% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

• superpathway of enterobacterial common antigen biosynthesis (9/10 steps found)
• dTDP-N-acetylthomosamine biosynthesis (4/4 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Protein Sequence (224 amino acids)

>BNILDI_04840 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Escherichia coli ECRC62)
VPVRASIEPLTWENAFFGVNSAIVRITSEAPLLTPDVLAPWSRVQAKIAASNTGELDALQ
LLGFSLVEGEVDLALPVNNASDSGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASS
RFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAGRGAGAELMQT
ALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR