Protein Info for BNILDI_04760 in Escherichia coli ECRC62

Name: ilvY
Annotation: HTH-type transcriptional activator IlvY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 219 to 242 (24 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 62 (60 residues), 81 bits, see alignment E=4.9e-27 PF03466: LysR_substrate" amino acids 89 to 293 (205 residues), 126.9 bits, see alignment E=7.2e-41

Best Hits

Swiss-Prot: 100% identical to ILVY_ECOLI: HTH-type transcriptional regulator IlvY (ilvY) from Escherichia coli (strain K12)

KEGG orthology group: K02521, LysR family transcriptional regulator, positive regulator for ilvC (inferred from 100% identity to eco:b3773)

Predicted SEED Role

"HTH-type transcriptional regulator IlvY" in subsystem Alanine biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>BNILDI_04760 HTH-type transcriptional activator IlvY (Escherichia coli ECRC62)
LDLRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLTEA
GEELRVFAQQTLLQYQQLRHTIDQQGPSLSGELHIFCSVTAAYSHLPPILDRFRAEHPSV
EIKLTTGDAADAMEKVVTGEADLAIAGKPETLPGAVAFSMLENLAVVLIAPALPCPVRNQ
VSVEKPDWSTVPFIMADQGPVRRRIELWFRRNKISNPMIYATVGGHEAMVSMVALGCGVA
LLPEVVLENSPEPVRNRVMILERSDEKTPFELGVCAQKKRLHEPLIEAFWKILPNH