Protein Info for BNILDI_04745 in Escherichia coli ECRC62
Name: ilvE
Annotation: branched-chain-amino-acid transaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ILVE_ECOLI: Branched-chain-amino-acid aminotransferase (ilvE) from Escherichia coli (strain K12)
KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 100% identity to eco:b3770)MetaCyc: 100% identical to branched-chain-amino-acid aminotransferase (Escherichia coli K-12 substr. MG1655)
Branched-chain-amino-acid transaminase. [EC: 2.6.1.42, 2.6.1.6]; 2.6.1.42 [EC: 2.6.1.42, 2.6.1.6]; 2.6.1.42 [EC: 2.6.1.42, 2.6.1.6]; Aspartate transaminase. [EC: 2.6.1.42, 2.6.1.6, 2.6.1.1, 2.6.1.27, 2.6.1.57]
Predicted SEED Role
"Branched-chain amino acid aminotransferase (EC 2.6.1.42)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Isoleucine degradation or Leucine Biosynthesis or Leucine Degradation and HMG-CoA Metabolism or Pyruvate Alanine Serine Interconversions or Valine degradation (EC 2.6.1.42)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- aspartate superpathway (24/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-threonine metabolism (16/18 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-leucine biosynthesis (6/6 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
- L-valine biosynthesis (4/4 steps found)
- superpathway of L-alanine biosynthesis (4/4 steps found)
- superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- L-alanine biosynthesis I (2/2 steps found)
- L-glutamate degradation II (2/2 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- L-tyrosine degradation I (4/5 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-aspartate biosynthesis (1/1 steps found)
- L-aspartate degradation I (1/1 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
- L-asparagine degradation III (mammalian) (2/3 steps found)
- L-isoleucine biosynthesis V (2/3 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-phenylalanine degradation II (anaerobic) (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- L-isoleucine biosynthesis IV (4/6 steps found)
- L-isoleucine degradation I (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-isoleucine biosynthesis III (4/7 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
- (R)-cysteate degradation (1/3 steps found)
- L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
- L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
- indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
- sulfolactate degradation III (1/3 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (5/9 steps found)
- superpathway of plastoquinol biosynthesis (2/5 steps found)
- L-isoleucine biosynthesis II (4/8 steps found)
- L-valine degradation I (4/8 steps found)
- L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
- L-leucine degradation I (2/6 steps found)
- superpathway of sulfolactate degradation (2/6 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- coenzyme M biosynthesis II (1/6 steps found)
- indole-3-acetate biosynthesis II (3/12 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- tropane alkaloids biosynthesis (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (2/14 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine metabolism
- Glutamate metabolism
- Lysine biosynthesis
- Methionine metabolism
- Novobiocin biosynthesis
- Pantothenate and CoA biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tryptophan metabolism
- Tyrosine metabolism
- Valine, leucine and isoleucine biosynthesis
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.1, 2.6.1.57
Use Curated BLAST to search for 2.6.1.1 or 2.6.1.27 or 2.6.1.42 or 2.6.1.57 or 2.6.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (309 amino acids)
>BNILDI_04745 branched-chain-amino-acid transaminase (Escherichia coli ECRC62) MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK WGWLDQVNQ