Protein Info for BNILDI_04665 in Escherichia coli ECRC62

Name: rbsR
Annotation: ribose operon transcriptional repressor RbsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00356: LacI" amino acids 3 to 48 (46 residues), 74.4 bits, see alignment 1e-24 PF00532: Peripla_BP_1" amino acids 59 to 321 (263 residues), 121.5 bits, see alignment E=1e-38 PF13407: Peripla_BP_4" amino acids 62 to 305 (244 residues), 68 bits, see alignment E=2e-22 PF13377: Peripla_BP_3" amino acids 170 to 329 (160 residues), 137.4 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 99% identical to RBSR_ECO57: Ribose operon repressor (rbsR) from Escherichia coli O157:H7

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 99% identity to eco:b3753)

MetaCyc: 47% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>BNILDI_04665 ribose operon transcriptional repressor RbsR (Escherichia coli ECRC62)
LATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYAPSALARSLKLNQTH
TIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRNLETLMQKRVDGLL
LLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNSLLGGDLATQYLIDKGHTRI
ACITGPLDKTPARLRLEGYRAAMKRAGLSIPDGYEVTGDFEFNGGFDAMRQLLSHPLRPQ
AVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELASFMTPPLTTIHQPKDELGELA
IDVLIHRITQPTLQQQRLQLTPILMERGSA