Protein Info for BNILDI_04450 in Escherichia coli ECRC62

Name: yieH
Annotation: 6-phosphogluconate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 4 to 179 (176 residues), 80.5 bits, see alignment E=2.2e-26 PF13419: HAD_2" amino acids 7 to 183 (177 residues), 76.9 bits, see alignment E=2.3e-25 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 67 to 183 (117 residues), 44.7 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 100% identical to YIEH_ECOLI: 6-phosphogluconate phosphatase (yieH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3715)

MetaCyc: 100% identical to 6-phosphogluconate phosphatase (Escherichia coli K-12 substr. MG1655)
3.1.3.-

Predicted SEED Role

"Putative phosphatase YieH" in subsystem 2-phosphoglycolate salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>BNILDI_04450 6-phosphogluconate phosphatase (Escherichia coli ECRC62)
MSQIEAVFFDCDGTLVDSEVICSRAYVTMFQEFGITLDPEEVFKRFKGVKLYEIIDIVSL
EHGVTLAKTEAEHVYRAEVARLFDSELEAIEGAGALLSAITAPMCVVSNGPNNKMQHSMG
KLNMLHYFPDKLFSGYDIQRWKPDPALMFHAAKAMNVNVENCILVDDSVAGAQSGIDAGM
EVFYFCADPHNKPIVHPKVTTFTHLSQLPELWKARGWDITA