Protein Info for BNILDI_04440 in Escherichia coli ECRC62

Name: yieF
Annotation: class I chromate reductase YieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 6 to 148 (143 residues), 150.3 bits, E=3.3e-48
• PF02525: Flavodoxin_2
  • amino acids 18 to 117 (100 residues), 36.9 bits, E=3.3e-13

Best Hits

Swiss-Prot: 100% identical to CHRR_ECOLI: Quinone reductase (chrR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3713)

MetaCyc: 100% identical to quinone reductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]; RXN0-3381 [EC: 1.6.5.2]

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Protein Sequence (188 amino acids)

>BNILDI_04440 class I chromate reductase YieF (Escherichia coli ECRC62)
MSEKLKVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFP
ATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGV
IGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVIDQGTLDHLTGQLTAFG
EFIQRVKI