Protein Info for BNILDI_04395 in Escherichia coli ECRC62

Name: rnpA
Annotation: ribonuclease P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF00825: Ribonuclease_P" amino acids 1 to 100 (100 residues), 108.5 bits, see alignment E=8.9e-36 TIGR00188: ribonuclease P protein component" amino acids 5 to 104 (100 residues), 122.2 bits, see alignment E=5.7e-40

Best Hits

Swiss-Prot: 100% identical to RNPA_ECOUT: Ribonuclease P protein component (rnpA) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 100% identity to eco:b3704)

MetaCyc: 100% identical to RNase P protein component (Escherichia coli K-12 substr. MG1655)
Ribonuclease P. [EC: 3.1.26.5]; 3.1.26.5 [EC: 3.1.26.5]

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>BNILDI_04395 ribonuclease P protein component (Escherichia coli ECRC62)
LLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAHERNRIKRLTRE
SFRLRQHELPAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS