Protein Info for BNILDI_03410 in Escherichia coli ECRC62

Name: bcsZ
Annotation: cellulose synthase complex periplasmic endoglucanase BcsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01270: Glyco_hydro_8" amino acids 1 to 346 (346 residues), 537.4 bits, see alignment E=6.6e-166

Best Hits

Swiss-Prot: 100% identical to GUN_ECO57: Endoglucanase (bcsZ) from Escherichia coli O157:H7

KEGG orthology group: K01179, endoglucanase [EC: 3.2.1.4] (inferred from 100% identity to eco:b3531)

MetaCyc: 100% identical to endo-1,4-D-glucanase (Escherichia coli K-12 substr. MG1655)
Cellulase. [EC: 3.2.1.4]

Predicted SEED Role

"Endoglucanase precursor (EC 3.2.1.4)" (EC 3.2.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>BNILDI_03410 cellulose synthase complex periplasmic endoglucanase BcsZ (Escherichia coli ECRC62)
MNVLRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFFALAANDRVAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH