Protein Info for BNILDI_03380 in Escherichia coli ECRC62

Name: pdeH
Annotation: cyclic-guanylate-specific phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00563: EAL" amino acids 26 to 242 (217 residues), 111.5 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 100% identical to PDEH_ECOLI: Cyclic di-GMP phosphodiesterase PdeH (pdeH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3525)

MetaCyc: 100% identical to cyclic di-GMP phosphodiesterase PdeH (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"GGDEF/EAL domain protein YhjH"

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>BNILDI_03380 cyclic-guanylate-specific phosphodiesterase (Escherichia coli ECRC62)
MIRQVIQRISNPEASIESLQERRFWLQCERAYTWQPIYQTCGRLMAVELLTVVTHPLNPS
QRLPPDRYFTEITVSHRMEVVKEQIDLLAQKADFFIEHGLLASVNIDGPTLIALRQQPKI
LRQIERLPWLRFELVEHIRLPKDSTFASMCEFGPLWLDDFGTGMANFSALSEVRYDYIKI
ARELFVMLRQSPEGRTLFSQLLHLMNRYCRGVIVEGVETPEEWRDVQNSPAFAAQGWFLS
RPAPIETLNTAVLAL