Protein Info for BNILDI_03345 in Escherichia coli ECRC62

Name: ccp
Annotation: cytochrome c peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details PF14376: Haem_bd" amino acids 19 to 152 (134 residues), 101 bits, see alignment E=8e-33 PF03150: CCP_MauG" amino acids 185 to 332 (148 residues), 179.3 bits, see alignment E=1.1e-56 PF00034: Cytochrom_C" amino acids 340 to 453 (114 residues), 24.3 bits, see alignment E=1e-08

Best Hits

Swiss-Prot: 100% identical to YHJA_ECOLI: Probable cytochrome c peroxidase (yhjA) from Escherichia coli (strain K12)

KEGG orthology group: K00428, cytochrome c peroxidase [EC: 1.11.1.5] (inferred from 100% identity to eco:b3518)

MetaCyc: 100% identical to cytochrome c peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.-; 1.11.1.-; 1.11.1.-

Predicted SEED Role

"Cytochrome c551 peroxidase (EC 1.11.1.5)" (EC 1.11.1.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>BNILDI_03345 cytochrome c peroxidase (Escherichia coli ECRC62)
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLGVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ