Protein Info for BNILDI_03335 in Escherichia coli ECRC62

Name: gadX
Annotation: acid resistance transcriptional activator GadX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 116 to 136 (21 residues), see Phobius details PF12833: HTH_18" amino acids 164 to 242 (79 residues), 64.2 bits, see alignment E=1.1e-21 PF00165: HTH_AraC" amino acids 205 to 240 (36 residues), 46.8 bits, see alignment 2.3e-16

Best Hits

Swiss-Prot: 100% identical to GADX_SHIFL: HTH-type transcriptional regulator GadX (gadX) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to eco:b3516)

Predicted SEED Role

"HTH-type transcriptional regulator gadX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>BNILDI_03335 acid resistance transcriptional activator GadX (Escherichia coli ECRC62)
MQSLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIRVDKCVENFVLVSRDTLS
LFLPMLKEEALNLHAHKKISSLLVHHCSRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFA
LLSVFLEDEHFIPLLLNVLQPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLR
EEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ
ERSAQGLPNRDSAASIVAQGNFYGTDRSAEGIRL