Protein Info for BNILDI_03105 in Escherichia coli ECRC62

Name: ptsN
Annotation: PTS suar transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00359: PTS_EIIA_2
  • amino acids 6 to 149 (144 residues), 116.2 bits, E=6e-38

Best Hits

KEGG orthology group: K02773, PTS system, galactitol-specific IIA component [EC: 2.7.1.69] (inferred from 97% identity to eum:ECUMN_3964)

Predicted SEED Role

"Putative carbohydrate PTS system, IIA component (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (157 amino acids)

>BNILDI_03105 PTS suar transporter subunit IIA (Escherichia coli ECRC62)
MQGIHFQENYIQRLPAGLSVEQIIRQLAQPLVAAELVVPDFADHVLKREATYPTGLPTEP
PCVAIPHTDHKHVRHNAIAVGILPEPVEFADMGGDPDPVPVRVIFLLALSESNKQLNALG
WIMEMIQDTPFMQALLAMETTEIHTVILNKMKERGEI